• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated DBR1 Monoclonal antibody

DBR1 Monoclonal Antibody for IF/ICC
Cat No. CL488-66951
Clone No.3B5A7

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat, Pig

Applications

IF/ICC

DBR1, Lariat debranching enzyme

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66951 targets DBR1 in IF/ICC applications and shows reactivity with Human, Mouse, Rat, Pig samples.

Tested Reactivity Human, Mouse, Rat, Pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8830

Product name: Recombinant human DBR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 204-544 aa of BC009472

Sequence: TLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLEYDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDPSKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA

Predict reactive species
Full Name debranching enzyme homolog 1 (S. cerevisiae)
Calculated Molecular Weight 544 aa, 62 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC009472
Gene Symbol DBR1
Gene ID (NCBI) 51163
RRIDAB_2919395
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UK59
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DBR1(Lariat debranching enzyme) hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules. DBR1 belongs to the lariat debranching enzyme family. Inhibiton of Dbr1 can suppress TDP-43 toxicity in primary neurons, suggesting that Dbr1 could be a potential therapeutic target for ALS and related TDP-43 proteinopathies (PMID: 23104007). This protein has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DBR1 antibody CL488-66951Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...