DCDC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DCDC2 Polyclonal antibody, PBS Only (26978-1-PBS)

• 

  WB analysis of mouse placenta using 26978-1-AP (same clone as 26978-1-PBS)

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 26978-1-AP (DCDC2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26978-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 26978-1-AP (same clone as 26978-1-PBS)

  WB result of DCDC2 antibody (26978-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DCDC2 transfected HepG2 cells. This data was developed using the same antibody clone with 26978-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human Hepatocellular carcinoma using 26978-1-AP (same clone as 26978-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human Hepatocellular carcinoma slide using 26978-1-AP (DCDC2 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26978-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 26978-1-AP (same clone as 26978-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human liver cancer tissue using DCDC2 antibody (26978-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26978-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DCDC2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 26978-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

DCDC2A, Doublecortin domain-containing protein 2, Protein RU2S, RU2, RU2S

---

Product Information

26978-1-PBS targets DCDC2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25577

  Product name: Recombinant human DCDC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 351-476 aa of BC050704

  Sequence: EDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVNNELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA

• Full Name: doublecortin domain containing 2
• Calculated Molecular Weight: 476 aa, 53 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC050704
• Gene Symbol: DCDC2
• Gene ID (NCBI): 51473
• RRID: AB_2880709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHG0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCDC2 (Doublecortin domain-containing protein 2), also known as KIAA1154. DCDC2 is expressed in the central nervous system of adults and fetuses, especially in the olfactory cortex, inferior temporal cortex, medial temporal cortex, hypothalamus, amygdala and hippocampus. DCDCDC2 protein contains two dicortical protein domains that bind to microtubules and enhance microtubule polymerization, which may play a role in neuronal migration and affect the signal transduction of primary cilia. In addition, DCDC2 also plays a role in inhibiting classical WNT signaling. DCDC2 may affect the development and function of the brain by affecting the migration of neurons and the signal conduction of primary cilia, and then it is related to reading ability (PMID: 21457949). The molecular weight of DCDC2 is 52 kDa, it also has another isoform with a molecular weight of 25 kDa.