CoraLite® Plus 488-conjugated DCLK1 Monoclonal antibody

DCLK1 Monoclonal Antibody for IF-P
Cat No. CL488-68234
Clone No.3C12C1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, rabbit, pig

Applications

IF-P

DCAMKL1, DCDC3A, DCLK, DCLK1, doublecortin like kinase 1, KIAA0369

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68234 targets DCLK1 in IF-P applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.

Tested Reactivity Human, mouse, rat, rabbit, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17110

Product name: Recombinant human DCLK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 623-729 aa of BC152456

Sequence: LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

Predict reactive species
Full Name doublecortin-like kinase 1
Calculated Molecular Weight 729 aa, 81 kDa
Observed Molecular Weight46 kDa, 82 kDa
GenBank Accession NumberBC152456
Gene Symbol DCLK1
Gene ID (NCBI) 9201
RRIDAB_3084450
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO15075
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DCLK1 antibody CL488-68234Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...