CoraLite® Plus 488-conjugated DCLK1 Monoclonal antibody

• 

  IF Staining of mouse brain using CL488-68234

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 DCLK1 antibody (CL488-68234, Clone: 3C12C1 ) at dilution of 1:200.

DCLK1 Monoclonal Antibody for IF-P

Cat No. CL488-68234

Clone No.3C12C1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, rabbit, pig

Applications

IF-P

Synonyms

DCAMKL1, DCDC3A, DCLK, DCLK1, doublecortin like kinase 1, KIAA0369

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68234 targets DCLK1 in IF-P applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.

• Tested Reactivity: Human, mouse, rat, rabbit, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17110

  Product name: Recombinant human DCLK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 623-729 aa of BC152456

  Sequence: LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

• Full Name: doublecortin-like kinase 1
• Calculated Molecular Weight: 729 aa, 81 kDa
• Observed Molecular Weight: 46 kDa, 82 kDa
• GenBank Accession Number: BC152456
• Gene Symbol: DCLK1
• Gene ID (NCBI): 9201
• RRID: AB_3084450
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O15075
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.