DCP1A Polyclonal antibody

• 

  WB analysis using 22373-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22373-1-AP (DCP1A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 22373-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 22373-1-AP (DCP1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 22373-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22373-1-AP (DCP1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 22373-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 22373-1-AP (DCP1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 22373-1-AP

  IP result of anti-DCP1A (IP:22373-1-AP, 4ug; Detection:22373-1-AP 1:3000) with mouse brain tissue lysate 3200ug.

• 

  IHC staining of mouse lung using 22373-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 22373-1-AP (DCP1A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 22373-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 22373-1-AP (DCP1A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 22373-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DCP1A antibody (22373-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 22373-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DCP1A antibody (22373-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 22373-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human DCP1A (22373-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

DCP1A Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 22373-1-AP

Publications(12)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, RIP, ELISA

Synonyms

EC:3.6.1.62, HSA275986, mRNA decapping enzyme 1A, mRNA-decapping enzyme 1A, Nbla00360

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, mouse lung tissue, Jurkat cells, MCF-7 cells, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IF: See 5 publications below
• IP: See 1 publications below
• RIP: See 2 publications below

Product Information

22373-1-AP targets DCP1A in WB, IHC, IF/ICC, FC (Intra), IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18027

  Product name: Recombinant human DCP1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC007439

  Sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR

• Full Name: DCP1 decapping enzyme homolog A (S. cerevisiae)
• Calculated Molecular Weight: 582 aa, 63 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC007439
• Gene Symbol: DCP1A
• Gene ID (NCBI): 55802
• RRID: AB_2879092
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NPI6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCP1 decapping enzyme homolog A (S. cerevisiae), known as mRNA-decapping enzyme 1A (DCP1A),is necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1. This antibody specifically react with the 70kd DCP1A protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	RIP	Cell Rep; Vault RNAs aid RNA virus infection by facilitating cytoplasmic localization of hnRNP C and ELAVL1; Authors - Jorn E Stok
human	WB,IF	FEBS Lett; Gemin5 plays a role in unassembled-U1 snRNA disposal in SMN-deficient cells.; Authors - Dongxu Jiang
	WB	Oxid Med Cell Longev; P-Glycoprotein Exacerbates Brain Injury Following Experimental Cerebral Ischemia by Promoting Proinflammatory Microglia Activation; Authors - Yan Chen
	WB	Vet Res; The Seneca Valley virus 3C protease cleaves DCP1A to attenuate its antiviral effects; Authors - Jingjing Yang
human	WB	J Proteome Res; Quantitative Proteomics Reveal the Mechanism of MiR-138-5p Suppressing Cervical Cancer via Targeting ZNF385A; Authors - Qihang Peng
mouse	IF	Mol Reprod Dev; The RNA-Binding Protein IGF2BP1 Marks Germ Cells but Is Dispensable for Mouse Fertility; Authors - Shu Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Laurens (Verified Customer) (02-02-2024)

Works well for ICC with bright stain and no background, shown with green channel in image.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: A549 cells, U2OS cells, HEK293 cells

DCP1A Antibody Immunofluorescence validation (1:500 dilution) in A549 cells, U2OS cells, HEK293 cells (Cat no:22373-1-AP)

FH

Tatyana (Verified Customer) (12-04-2023)

Detects P-bodies in ICC, good signal

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human / HeLa cells

DCP1A Antibody Immunofluorescence validation (1:1000 dilution) in Human / HeLa cells (Cat no:22373-1-AP)