• Featured Product
  • KD/KO Validated

DCP1A Recombinant monoclonal antibody

DCP1A Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 85047-5-RR
Clone No.242553F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

EC:3.6.1.62, HSA275986, mRNA decapping enzyme 1A, mRNA-decapping enzyme 1A, Nbla00360

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, HEK-293 cells, Jurkat cells, MCF-7 cells, SW480 cells, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85047-5-RR targets DCP1A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18027

Product name: Recombinant human DCP1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC007439

Sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR

Predict reactive species
Full Name DCP1 decapping enzyme homolog A (S. cerevisiae)
Calculated Molecular Weight 582 aa, 63 kDa
Observed Molecular Weight70-75 kDa
GenBank Accession NumberBC007439
Gene Symbol DCP1A
Gene ID (NCBI) 55802
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NPI6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCP1 decapping enzyme homolog A (S. cerevisiae), known as mRNA-decapping enzyme 1A (DCP1A),is necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1. This antibody specifically react with the 70kd DCP1A protein.

Protocols

Product Specific Protocols
IF protocol for DCP1A antibody 85047-5-RRDownload protocol
IHC protocol for DCP1A antibody 85047-5-RRDownload protocol
WB protocol for DCP1A antibody 85047-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...