CoraLite® Plus 488-conjugated DCP1A Recombinant monoclonal antibody

DCP1A Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85047-5
Clone No.242553F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

EC:3.6.1.62, HSA275986, mRNA decapping enzyme 1A, mRNA-decapping enzyme 1A, Nbla00360

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85047-5 targets DCP1A in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18027

Product name: Recombinant human DCP1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC007439

Sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR

Predict reactive species
Full Name DCP1 decapping enzyme homolog A (S. cerevisiae)
Calculated Molecular Weight 582 aa, 63 kDa
Observed Molecular Weight70-75 kDa
GenBank Accession NumberBC007439
Gene Symbol DCP1A
Gene ID (NCBI) 55802
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NPI6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DCP1 decapping enzyme homolog A (S. cerevisiae), known as mRNA-decapping enzyme 1A (DCP1A),is necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1. This antibody specifically react with the 70kd DCP1A protein.

Loading...
||
New chat Able
正在加载,请稍候...