CoraLite® Plus 488-conjugated DDB1 Monoclonal antibody

• 

  WB analysis using CL488-66010

  Various lysates were subjected to SDS PAGE followed by western blot with CL488-66010 (DDB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

DDB1 Monoclonal Antibody for WB

Cat No. CL488-66010

Clone No.4F6C6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB

Synonyms

DDB p127 subunit, DDB1, DDBA, DNA damage binding protein 1, DNA damage binding protein a, HBV X associated protein 1, UV damaged DNA binding factor, UV DDB 1, UV DDB1, XAP 1, XAP1, XPCE, XPE, XPE BF, XPE binding factor

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66010 targets DDB1 in WB applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17903

  Product name: Recombinant human DDB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-400 aa of BC011686

  Sequence: MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA

• Full Name: damage-specific DNA binding protein 1, 127kDa
• Calculated Molecular Weight: 1140 aa, 127 kDa
• Observed Molecular Weight: 127 kDa
• GenBank Accession Number: BC011686
• Gene Symbol: DDB1
• Gene ID (NCBI): 1642
• RRID: AB_3084196
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16531
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DDB1, also named as XAP1, XPCe, DDBa and XPE-BF, belongs to the DDB1 family. It is required for DNA repair. DDB1 binds to DDB2 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The functional specificity of the DCX E3 ubiquitin-protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. This antibody is specific to DDB1.