DDI2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DDI2 Polyclonal antibody, PBS Only (25377-1-PBS)

• 

  WB analysis using 25377-1-AP (same clone as 25377-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25377-1-AP (DDI2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25377-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 25377-1-AP (same clone as 25377-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DDI2 antibody (25377-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 25377-1-PBS in a different storage buffer formulation.

DDI2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25377-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Protein DDI1 homolog 2

---

Product Information

25377-1-PBS targets DDI2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21953

  Product name: Recombinant human DDI2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 22-62 aa of BC006011

  Sequence: DADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLA

• Full Name: DDI1, DNA-damage inducible 1, homolog 2 (S. cerevisiae)
• Calculated Molecular Weight: 399 aa, 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC006011
• Gene Symbol: DDI2
• Gene ID (NCBI): 84301
• RRID: AB_3669472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5TDH0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DDI2 contains 399 amino acids and contains an N-terminal ubiquitin-like (UBL) domain and a highly conserved retroviral protease-like (RVP) domain. DDI2 is an aspartic endoprotease that cleaves ubiquitylated target proteins to assist in their processing by the ubiquitin-proteasome system (UPS), especially when the UPS is inhibited(PMID: 32521225).