DDX18 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DDX18 Polyclonal antibody, PBS Only (28502-1-PBS)

• 

  WB analysis using 28502-1-AP (same clone as 28502-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28502-1-AP (DDX18 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28502-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293T using 28502-1-AP (same clone as 28502-1-PBS)

  IP result of anti-DDX18 (IP:28502-1-AP, 4ug; Detection:28502-1-AP 1:1500) with HEK-293T cells lysate 1560 ug. This data was developed using the same antibody clone with 28502-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 28502-1-AP (same clone as 28502-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using DDX18 antibody (28502-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 28502-1-PBS in a different storage buffer formulation.

DDX18 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 28502-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

28502-1-PBS targets DDX18 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27457

  Product name: Recombinant human DDX18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-165 aa of BC001238

  Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 80-85 kDa
• GenBank Accession Number: BC001238
• Gene Symbol: DDX18
• Gene ID (NCBI): 8886
• RRID: AB_2881158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVP1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.