DDX23 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 85763-4-RR (same clone as 85763-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85763-4-RR (DDX23 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85763-4-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02081-3

  The mean DDX23 concentration was determined to be 263.11 ng/mL in K-562 cell extract based on a 1.20 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02081-3

  Sandwich ELISA standard curve of MP02081-3, Human DDX23 Recombinant Matched Antibody Pair - PBS only. 85763-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0258. 85763-2-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL.

• 

  IHC staining of human ovary cancer using 85763-4-RR (same clone as 85763-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85763-4-RR (DDX23 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85763-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85763-4-RR (same clone as 85763-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DDX23 antibody (85763-4-RR, Clone: 243147B4 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85763-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85763-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85763-4-RR against Human DDX23 were performed. The affinity constant is below 1 pM.

DDX23 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 85763-4-PBS

Clone No.243147B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA

Synonyms

100 kDa U5 snRNP-specific protein, DEAD box protein 23, EC:3.6.4.13, Probable ATP-dependent RNA helicase DDX23, prp28

---

Product Information

85763-4-PBS targets DDX23 as part of a matched antibody pair:

MP02081-3: 85763-4-PBS capture and 85763-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0258

  Product name: Recombinant human DDX23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 614-820 aa of BC002366

  Sequence: ERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 23
• Calculated Molecular Weight: 96 kDa
• Observed Molecular Weight: 96-100 kDa
• GenBank Accession Number: BC002366
• Gene Symbol: DDX23
• Gene ID (NCBI): 9416
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BUQ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 (DDX23, synonyms: prp28, MGC8416, U5-100K) is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX23 is a component of the U5 snRNP complex; it may facilitate conformational changes in the spliceosome during nuclear pre-mRNA splicing.