CoraLite®594-conjugated DDX23 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL594-85763-4

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®594 DDX23 antibody (CL594-85763-4, Clone: 243147B4 ) at dilution of 1:200, CL488-Phalloidin (red).

• 

  IF Staining of U2OS using CL594-85763-4

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CoraLite®594 DDX23 antibody (CL594-85763-4, Clone: 243147B4 ) at dilution of 1:200.

DDX23 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL594-85763-4

Clone No.243147B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

100 kDa U5 snRNP-specific protein, DEAD box protein 23, EC:3.6.4.13, Probable ATP-dependent RNA helicase DDX23, prp28

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells, HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-85763-4 targets DDX23 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0258

  Product name: Recombinant human DDX23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 614-820 aa of BC002366

  Sequence: ERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 23
• Calculated Molecular Weight: 96 kDa
• Observed Molecular Weight: 96-100 kDa
• GenBank Accession Number: BC002366
• Gene Symbol: DDX23
• Gene ID (NCBI): 9416
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BUQ8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 (DDX23, synonyms: prp28, MGC8416, U5-100K) is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX23 is a component of the U5 snRNP complex; it may facilitate conformational changes in the spliceosome during nuclear pre-mRNA splicing.