DGAT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DGAT2 Polyclonal antibody, PBS Only (17100-1-PBS)

• 

  WB analysis using 17100-1-AP (same clone as 17100-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17100-1-AP (DGAT2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17100-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17100-1-AP (same clone as 17100-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17100-1-AP (DGAT2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17100-1-AP (same clone as 17100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17100-1-AP (DGAT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17100-1-PBS in a different storage buffer formulation.

DGAT2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17100-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.3.1.76, EC:2.3.1.20, Diglyceride acyltransferase 2, Diacylglycerol O-acyltransferase 2, ARAT

---

Product Information

17100-1-PBS targets DGAT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10719

  Product name: Recombinant human DGAT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 113-388 aa of BC015234

  Sequence: DWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN

• Full Name: diacylglycerol O-acyltransferase homolog 2 (mouse)
• Calculated Molecular Weight: 388 aa, 44 kDa
• Observed Molecular Weight: 39~44kDa
• GenBank Accession Number: BC015234
• Gene Symbol: DGAT2
• Gene ID (NCBI): 84649
• RRID: AB_2918049
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PD7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Diacylglycerol acyltransferase 2 (DGAT2) is an integral membrane protein and major enzyme that catalyzes the final step of triacylglycerol (TG) synthesis in eukaryotes (PMID: 21680734). DGAT2 is present in mitochondria-associated membranes, specialized domains of the ER that are highly enriched in lipid synthetic enzymes (PMID: 19049983). DGAT2 isoforms (39 kDa, 44kDa) have major differences in acyl-CoA substrate specificity toward erucoyl-CoA.