DHX36 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DHX36 Polyclonal antibody, PBS Only (13159-1-PBS)

• 

  WB analysis using 13159-1-AP (same clone as 13159-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13159-1-AP (DHX36 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13159-1-AP (same clone as 13159-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13159-1-AP (DHX36 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 13159-1-AP (same clone as 13159-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13159-1-AP (DHX36 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 13159-1-AP (same clone as 13159-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13159-1-AP (DHX36 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A431 using 13159-1-AP (same clone as 13159-1-PBS)

  IP result of anti-DHX36 (IP:13159-1-AP, 4ug; Detection:13159-1-AP 1:500) with A431 cells lysate 1000 ug. This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• 

  IP experiment of PC-3 using 13159-1-AP (same clone as 13159-1-PBS)

  IP result of anti-DHX36 (IP:13159-1-AP, 4ug; Detection:13159-1-AP 1:500) with PC-3 cells lysate 1760 ug. This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13159-1-AP (same clone as 13159-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13159-1-AP (DHX36 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13159-1-AP (same clone as 13159-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13159-1-AP (DHX36 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13159-1-AP (same clone as 13159-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13159-1-AP (DHX36 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13159-1-AP (same clone as 13159-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13159-1-AP (DHX36 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13159-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DHX36 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13159-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

ATP-dependent DNA/RNA helicase DHX36, DDX36, DEAD/H box polypeptide 36, DEAH-box protein 36, EC:3.6.4.12

---

Product Information

13159-1-PBS targets DHX36 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3799

  Product name: Recombinant human DHX36 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-385 aa of BC036035

  Sequence: MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQGQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDLKVILMSATLNAEKFSEYFGNCPMIH

• Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 36
• Calculated Molecular Weight: 1008 aa, 115 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC036035
• Gene Symbol: DHX36
• Gene ID (NCBI): 170506
• RRID: AB_2092157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2U1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DHX36, also known as RNA associated with AU-rich element (RHAU) and G4R1, is an adenosine triphosphate (ATP)-dependent RNA helicase that belongs to the DExH/D family of RNA modifying enzymes. Proteins in this family involve in a wide range of cellular functions including RNA splicing, ribosome assembly, messenger RNA (mRNA) stability, microRNA processing, ribonucleoprotein remodeling and RNA trafficking. DHX36 is an RNA helicase that has specificity for DNA and RNA G4-quadruplexes, and resolves G4 structures into separate nucleotide strands for metabolic processing of G-rich sequence.