Smac/DIABLO Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Smac/DIABLO Polyclonal antibody, PBS Only (10434-1-PBS)

• 

  WB analysis using 10434-1-AP (same clone as 10434-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10434-1-AP (DIABLO antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10434-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10434-1-AP (same clone as 10434-1-PBS)

  WB result of DIABLO antibody (10434-1-AP; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DIABLO transfected HeLa cells. This data was developed using the same antibody clone with 10434-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 10434-1-AP (same clone as 10434-1-PBS)

  IP result of anti-DIABLO (IP:10434-1-AP, 4ug; Detection:10434-1-AP 1:2000) with HepG2 cells lysate 880 ug. This data was developed using the same antibody clone with 10434-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10434-1-AP (same clone as 10434-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10434-1-AP (DIABLO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10434-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10434-1-AP (same clone as 10434-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DIABLO antibody (10434-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10434-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10434-1-AP (same clone as 10434-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DIABLO antibody (10434-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10434-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 10434-1-AP (same clone as 10434-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human DIABLO (10434-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 10434-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Smac/DIABLO Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 10434-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

DIABLO, DFNA64, Direct IAP-binding protein with low pI, Diablo IAP-binding mitochondrial protein, cleaved form, Diablo IAP-binding mitochondrial protein

---

Product Information

10434-1-PBS targets Smac/DIABLO in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0696

  Product name: Recombinant human DIABLO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC011909

  Sequence: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

• Full Name: diablo homolog (Drosophila)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC011909
• Gene Symbol: DIABLO
• Gene ID (NCBI): 56616
• RRID: AB_2092647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR28
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Smac/DIABLO is a mitochondrial protein that promotes apoptosis by neutralizing members of the IAP family. SMAC/DIABLO is ubiquitously expressed in normal tissues, and the expression of SMAC messenger RNA (mRNA) in adult testis is the highest .Smac/DIABLO encodes a 239 amino acid protein (~27 kDa). The first 55 amino acids are a mitochondrial targeting signal peptide that is cleaved to generate mature Smac-DIABLO (~21 kDa). When released from mitochondria, Smac-DIABLO acts as a natural antagonist of inhibitor of apoptosis proteins (IAPs). Smac-DIABLO antagonistic activity is based on its N-terminal tetrapeptide (AVPI) that binds baculoviral IAP repeat (BIR) domains of IAPs, releasing their inhibitory effects on both initiator and effector caspases, thus promoting cell death. (PMID: 32325691, PMID: 32575872,PMID: 25650938)