CoraLite® Plus 488-conjugated DIDO1 Polyclonal antibody

DIDO1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10183

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

BYE1, C20orf158, DATF 1, DATF1, DATF-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10183 targets DIDO1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0237

Product name: Recombinant human DIDO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 345-544 aa of BC000770

Sequence: ADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILKHAAATMKFLSSGKEQKPKPKEKMKMKPEKPSLPKCGAQAGIKISSVHKRPAPEKKETTVKKAVVVPARSEALGKEAACESSTPSWASDHNYNAVKPEKTAAPSPSLLYKCSGKYLYSLHPSLIA

Predict reactive species
Full Name death inducer-obliterator 1
Calculated Molecular Weight 244 kDa
Observed Molecular Weight 300-350 kDa
GenBank Accession NumberBC000770
Gene Symbol DIDO1
Gene ID (NCBI) 11083
RRIDAB_3672431
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BTC0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DIDO1, also termed DATF-1, C20orf158, DATF1, KIAA0333 and DIO-1, is a putative transcription factor, weakly pro-apoptotic when overexpressed. It is a tumor suppressor. In mice, DIDO1 is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. The human DIDO1 is similar to the mouse gene and therefore is thought to be involved in apoptosis.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 DIDO1 antibody CL488-10183Download protocol
IF protocol for CL Plus 488 DIDO1 antibody CL488-10183Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...