DIO1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DIO1 Polyclonal antibody (11790-1-AP)

DIO1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 11790-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

5DI, DIOI, EC:1.21.99.4, ITDI1, TXDI1

• 

  WB analysis of mouse lung using 11790-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse ovary using 11790-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat lung using 11790-1-AP

  rat lung tissue were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 11790-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 11790-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11790-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 11790-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11790-1-AP (DIO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 11790-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11790-1-AP (DIO1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11790-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 11790-1-AP (DIO1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11790-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 11790-1-AP (DIO1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 11790-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11790-1-AP (DIO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 11790-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11790-1-AP (DIO1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 11790-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using DIO1 antibody (11790-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 11790-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug DIO1 Polyclonal antibody (11790-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DIO1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue, HeLa cells, mouse ovary tissue, rat lung tissue, U-937 cells, A549 cells
• Positive IHC detected in: human liver cancer tissue, human kidney tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11790-1-AP targets DIO1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2410

  Product name: Recombinant human DIO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-125 aa of BC017955

  Sequence: GLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT

• Full Name: deiodinase, iodothyronine, type I
• Calculated Molecular Weight: 249 aa, 29 kDa
• Observed Molecular Weight: 29 kDa, 13 kDa
• GenBank Accession Number: BC017955
• Gene Symbol: DIO1
• Gene ID (NCBI): 1733
• RRID: AB_10949197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49895
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DIO1(Type I iodothyronine deiodinase) is also named as ITDI1, TXDI1,5DI,DIOI and belongs to the iodothyronine deiodinase family.It is a membrane selenoprotein that catalyzes the deiodination of L-thyroxine to the biologically active thyroid hormone 3,3′,5-triiodothyronine.DIO1 is located in liver, kidney, and thyroid,which has both ORD and IRD activities(PMID: 9389495). It has some isoforms produced by alternative splicing with the MW of 29 kDa, 21 kDa, 13 kDa, 23 kDa, 19 kDa, 4 kDa, 13 kDa, 9 kDa and 10 kDa.

Publications

What published studies show

The DIO1 Polyclonal antibody (Cat# 11790-1-AP) has 16 citations published in journals including Molecular Cell, Cell Reports, Life Sciences, Food & Function, Frontiers in Endocrinology, Chemosphere, Scientific Reports, Frontiers in Physiology, Breast Cancer, Journal of Biological Chemistry, Endocrinology, Journal of Animal Science, Biomedical Research International, and bioRxiv. Research fields span thyroid hormone metabolism, hepatic steatosis/NASH, ferroptosis, obesity, skeletal muscle physiology, breast cancer, pancreatic islet biology, preeclampsia, and zebrafish development.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Mol Cell; Hypoxia-driven lncRNA SHIELD promotes GPX4 translation and protects against ferroptosis in hepatocellular carcinoma.; Authors - Kejia Liu
mouse	IF	Cell Rep; Environmental Enrichment Induces Pericyte and IgA-Dependent Wound Repair and Lifespan Extension in a Colon Tumor Model.; Authors - Benjamin D Bice
mouse	WB	Life Sci; Role of diets and exercise in ameliorating obesity-related hepatic steatosis: Insights at the microRNA-dependent thyroid hormone synthesis and action.; Authors - Shu-Fang Xia
mouse	WB	Food Funct; Myricetin alleviated hepatic steatosis by acting on microRNA-146b/thyroid hormone receptor b pathway in high-fat diet fed C57BL/6J mice.; Authors - Shu-Fang Xia
rat	WB	Front Endocrinol (Lausanne); Reduced Skeletal Muscle Protein Turnover and Thyroid Hormone Metabolism in Adaptive Thermogenesis That Facilitates Body Fat Recovery During Weight Regain.; Authors - Julie Calonne
mouse	IHC	Front Endocrinol (Lausanne); Role of aerobic exercise in ameliorating NASH: Insights into the hepatic thyroid hormone signaling and circulating thyroid hormones; Authors - Qiuhong Liu