CoraLite® Plus 488-conjugated DIO1 Polyclonal antibody

DIO1 Polyclonal Antibody for IF/ICC
Cat No. CL488-11790

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

5DI, DIO1, DIOI, ITDI1, TXDI1, Type 1 DI, Type I 5 deiodinase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11790 targets DIO1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2410

Product name: Recombinant human DIO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-125 aa of BC017955

Sequence: GLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT

Predict reactive species
Full Name deiodinase, iodothyronine, type I
Calculated Molecular Weight 249 aa, 29 kDa
Observed Molecular Weight 29 kDa, 13 kDa
GenBank Accession NumberBC017955
Gene Symbol DIO1
Gene ID (NCBI) 1733
RRIDAB_3672513
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49895
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DIO1(Type I iodothyronine deiodinase) is also named as ITDI1, TXDI1,5DI,DIOI and belongs to the iodothyronine deiodinase family.It is a membrane selenoprotein that catalyzes the deiodination of L-thyroxine to the biologically active thyroid hormone 3,3′,5-triiodothyronine.DIO1 is located in liver, kidney, and thyroid,which has both ORD and IRD activities(PMID: 9389495). It has some isoforms produced by alternative splicing with the MW of 29 kDa, 21 kDa, 13 kDa, 23 kDa, 19 kDa, 4 kDa, 13 kDa, 9 kDa and 10 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DIO1 antibody CL488-11790Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...