DIO1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DIO1 Polyclonal antibody, PBS Only (11790-1-PBS)

• 

  WB analysis of mouse lung using 11790-1-AP (same clone as 11790-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse ovary using 11790-1-AP (same clone as 11790-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat lung using 11790-1-AP (same clone as 11790-1-PBS)

  rat lung tissue were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 11790-1-AP (same clone as 11790-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 11790-1-AP (same clone as 11790-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 11790-1-AP (same clone as 11790-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11790-1-AP (DIO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 11790-1-AP (same clone as 11790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11790-1-AP (DIO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 11790-1-AP (same clone as 11790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11790-1-AP (DIO1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 11790-1-AP (same clone as 11790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11790-1-AP (DIO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 11790-1-AP (same clone as 11790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11790-1-AP (DIO1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 11790-1-AP (same clone as 11790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 11790-1-AP (DIO1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 11790-1-AP (same clone as 11790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 11790-1-AP (DIO1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 11790-1-AP (same clone as 11790-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using DIO1 antibody (11790-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 11790-1-AP (same clone as 11790-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug DIO1 Polyclonal antibody (11790-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 11790-1-PBS in a different storage buffer formulation.

DIO1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 11790-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

Type 1 DI, TXDI1, ITDI1, EC:1.21.99.4, DIOI

---

Product Information

11790-1-PBS targets DIO1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2410

  Product name: Recombinant human DIO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-125 aa of BC017955

  Sequence: GLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT

• Full Name: deiodinase, iodothyronine, type I
• Calculated Molecular Weight: 249 aa, 29 kDa
• Observed Molecular Weight: 29 kDa, 13 kDa
• GenBank Accession Number: BC017955
• Gene Symbol: DIO1
• Gene ID (NCBI): 1733
• RRID: AB_10949197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49895
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DIO1(Type I iodothyronine deiodinase) is also named as ITDI1, TXDI1,5DI,DIOI and belongs to the iodothyronine deiodinase family.It is a membrane selenoprotein that catalyzes the deiodination of L-thyroxine to the biologically active thyroid hormone 3,3′,5-triiodothyronine.DIO1 is located in liver, kidney, and thyroid,which has both ORD and IRD activities(PMID: 9389495). It has some isoforms produced by alternative splicing with the MW of 29 kDa, 21 kDa, 13 kDa, 23 kDa, 19 kDa, 4 kDa, 13 kDa, 9 kDa and 10 kDa.