DLC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DLC1 Polyclonal antibody, PBS Only (15460-1-PBS)

• 

  IP experiment of mouse lung using 15460-1-AP (same clone as 15460-1-PBS)

  IP result of anti-DLC1 (IP:15460-1-AP, 4ug; Detection:15460-1-AP 1:300) with mouse lung tissue lysate 2400ug. This data was developed using the same antibody clone with 15460-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 15460-1-AP (same clone as 15460-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 15460-1-AP (DLC1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15460-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 15460-1-AP (same clone as 15460-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 15460-1-AP (DLC1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15460-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15460-1-AP (same clone as 15460-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15460-1-AP (DLC1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15460-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15460-1-AP (same clone as 15460-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15460-1-AP (DLC1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15460-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15460-1-AP (same clone as 15460-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using DLC1 antibody 15460-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 15460-1-PBS in a different storage buffer formulation.

DLC1 Polyclonal Antibody for IHC, IF/ICC, IP, Indirect ELISA

Cat No. 15460-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

15460-1-PBS targets DLC1 in IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7732

  Product name: Recombinant human DLC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1179-1528 aa of BC054511

  Sequence: KDQRLQAIKAAIMLLPDENREVLQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLGNDDSADYQHFLQDCVDGLFKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSVIEVPAVPEEILKRLLKEQHLWDVDLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACALLLTSVDHDRAPVVGVRVNVLLSRYLIEPCGPGKSKLTYMCRVDLRGHMPEWYTKSFGHLCAAEVVKIRDSFSNQNTETKDTKSR

• Full Name: deleted in liver cancer 1
• Calculated Molecular Weight: 171 kDa
• GenBank Accession Number: BC054511
• Gene Symbol: DLC1
• Gene ID (NCBI): 10395
• RRID: AB_2246077
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QB1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.