DNMT3B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNMT3B Polyclonal antibody, PBS Only (26971-1-PBS)

• 

  WB analysis using 26971-1-AP (same clone as 26971-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26971-1-AP (DNMT3B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26971-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26971-1-AP (same clone as 26971-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26971-1-AP (DNMT3B antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26971-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 26971-1-AP (same clone as 26971-1-PBS)

  IP result of anti-DNMT3B (IP:26971-1-AP, 4ug; Detection:26971-1-AP 1:5000) with K-562 cells lysate 1800 ug. This data was developed using the same antibody clone with 26971-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26971-1-AP (same clone as 26971-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26971-1-AP (DNMT3B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26971-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26971-1-AP (same clone as 26971-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26971-1-AP (DNMT3B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26971-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 26971-1-AP (same clone as 26971-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26971-1-AP (DNMT3B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26971-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 26971-1-AP (same clone as 26971-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26971-1-AP (DNMT3B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26971-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 26971-1-AP (same clone as 26971-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26971-1-AP (DNMT3B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26971-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 26971-1-AP (same clone as 26971-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26971-1-AP (DNMT3B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26971-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DNMT3B Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 26971-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

ICF, EC:2.1.1.37, DNMT3, DNMT, DNA (cytosine-5)-methyltransferase 3B

---

Product Information

26971-1-PBS targets DNMT3B in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25117

  Product name: Recombinant human DNMT3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001207055

  Sequence: MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES

• Full Name: DNA (cytosine-5-)-methyltransferase 3 beta
• Calculated Molecular Weight: 95 kDa
• Observed Molecular Weight: 85-96 kDa
• GenBank Accession Number: NM_001207055
• Gene Symbol: DNMT3B
• Gene ID (NCBI): 1789
• RRID: AB_2880705
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBC3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNMT3B is a DNA-(cytosine C5)-methyltransferase that is responsible for establishing the methylation patterns in cooperation with DNMT3A through the de novo methylation pathway. It is essential for the establishment of DNA methylation patterns during development. DNMT3B contains a C-terminal catalytic domain and an N-terminal regulatory domain, which are involved in targeting chromatin to regulate its function (PMID: 31547729). DNMT3B has 8 isoforms with the molecular mass of 80-96 kDa.