CoraLite®594 Anti-Human DR5/CD262 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using CL594-98273

  1x10^6 human PBMCs were surface stained with CoraLite® Plus 488 Anti-Human CD14, and 5 ul CoraLite®594 Anti-Human DR5/CD262 Rabbit RecAb (CL594-98273, Clone:242319H8), or CoraLite®594 Rabbit IgG Isotype Control RecAb (CL594-98136, Clone: 240953C9). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human PBMCs using CL594-98273

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite®594 Anti-Human DR5/CD262 Rabbit RecAb (CL594-98273, Clone:242319H8) (red), or CoraLite®594 Rabbit IgG Isotype Control RecAb (CL594-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

DR5/CD262 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL594-98273

Clone No.242319H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

DR5, 242319H8, CD262, Death receptor 5, KILLER

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98273 targets DR5/CD262 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1648

  Product name: Recombinant Human DR5 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 56-182 aa of BC001281

  Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

• Full Name: tumor necrosis factor receptor superfamily, member 10b
• Calculated Molecular Weight: 48 kDa
• GenBank Accession Number: BC001281
• Gene Symbol: DR5
• Gene ID (NCBI): 8795
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14763
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

DR5, also known as CD262, TNFRSF10B, TRAILR2, TRICK2 and KILLER, is a widely expressed single-pass type I membrane protein belonging to the tumour necrosis factor receptor superfamily (TNFRSF). It is a receptor for TNF-related apoptosis-inducing ligand (TRAIL), which is a member of the tumor necrosis factor (TNF) family of cytokines and induces apoptosis in a wide variety of cells (PMID: 9311998). DR5 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain (DD), through which DR5 is capable to transmit the apoptotic signal (PMID: 9311998; 20531300).