Tested Applications
| Positive FC detected in | human PBMCs |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
| This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
FITC-98273 targets DR5/CD262 in FC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1648 Product name: Recombinant Human DR5 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 56-182 aa of BC001281 Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE Predict reactive species |
| Full Name | tumor necrosis factor receptor superfamily, member 10b |
| Calculated Molecular Weight | 48 kDa |
| GenBank Accession Number | BC001281 |
| Gene Symbol | DR5 |
| Gene ID (NCBI) | 8795 |
| Conjugate | FITC Plus Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 495 nm / 524 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O14763 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
DR5, also known as CD262, TNFRSF10B, TRAILR2, TRICK2 and KILLER, is a widely expressed single-pass type I membrane protein belonging to the tumour necrosis factor receptor superfamily (TNFRSF). It is a receptor for TNF-related apoptosis-inducing ligand (TRAIL), which is a member of the tumor necrosis factor (TNF) family of cytokines and induces apoptosis in a wide variety of cells (PMID: 9311998). DR5 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain (DD), through which DR5 is capable to transmit the apoptotic signal (PMID: 9311998; 20531300).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FITC Plus DR5/CD262 antibody FITC-98273 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
