DRD5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DRD5 Polyclonal antibody, PBS Only (20310-1-PBS)

• 

  WB analysis using 20310-1-AP (same clone as 20310-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20310-1-AP (DRD5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20310-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20310-1-AP (same clone as 20310-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20310-1-AP (DRD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20310-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20310-1-AP (same clone as 20310-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20310-1-AP (DRD5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20310-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20310-1-AP (same clone as 20310-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20310-1-AP (DRD5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20310-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 20310-1-AP (same clone as 20310-1-PBS)

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.8 ug DRD5 Polyclonal antibody (20310-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.8 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 20310-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DRD5 Polyclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 20310-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

---

Product Information

20310-1-PBS targets DRD5 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14145

  Product name: Recombinant human DRD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 351-477 aa of BC009748

  Sequence: NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH

• Full Name: dopamine receptor D5
• Calculated Molecular Weight: 477 aa, 53 kDa
• Observed Molecular Weight: 50-53 kDa
• GenBank Accession Number: BC009748
• Gene Symbol: DRD5
• Gene ID (NCBI): 1816
• RRID: AB_10699880
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21918
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DRD5, is a G-protein coupled receptor and involved in diversified physiological and pathological processes. this receptor stimulates adenylyl cyclase activity and is expressed in the limbic area of the mammalian brain(PMID:14699430). Studies have shown that DRD5 is highly expressed in colonic macrophages and DRD5 deficiency exacerbates DSS(dextran sodium sulfate)-induced colitis(PMID:34001860). in addition, DRD5 agonists were potent inhibitors of pituitary tumor growth(PMID:28613975).