CoraLite® Plus 488-conjugated DSE Monoclonal antibody

DSE Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-60041
Clone No.2C9F7

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

IF/ICC, FC (Intra)

2C9F7, Chondroitin-glucuronate 5-epimerase, Dermatan-sulfate epimerase, DS epimerase, DSEPI

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60041 targets DSE in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0695

Product name: Recombinant human DSE protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 659-958 aa of BC039245

Sequence: RAAYLFIGPSIDVQSFTVHGDSQQLDVFIATSKHAYATYLWTGEATGQSAFAQVIADRHKILFDRNSAIKSSIVPEVKDYAAIVEQNLQHFKPVFQLLEKQILSRVRNTASFRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYTRLFLILNIAIFFVMLAMQLTYFQRAQSLHGQRCLYAVLLIDSCILLWLYSSCSQSQC

Predict reactive species
Full Name dermatan sulfate epimerase
Calculated Molecular Weight 958 aa, 110 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC039245
Gene Symbol DSE
Gene ID (NCBI) 29940
RRIDAB_3672860
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodEuglobulin precipitation
UNIPROT IDQ9UL01
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DSE, also named as SART2 and DSEPI, is an enzyme that converts D-glucuronic acid to L-iduronic acid residues in dermatan sulphate biosynthesis. It is also identified to be a tumour-associated antigen. DSE is recognized by cytotoxic T cells (CTLs) and its enhanced expression in many cancers has been reported. DSE is a potential candidate for a tumour antigen with immunogenicity.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 DSE antibody CL488-60041Download protocol
IF protocol for CL Plus 488 DSE antibody CL488-60041Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...