DUPD1 / DUSP27 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DUPD1 / DUSP27 Polyclonal antibody, PBS Only (25259-1-PBS)

• 

  WB analysis using 25259-1-AP (same clone as 25259-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25259-1-AP (DUPD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25259-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 25259-1-AP (same clone as 25259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25259-1-AP (DUPD1 / DUSP27 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25259-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 25259-1-AP (same clone as 25259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25259-1-AP (DUPD1 / DUSP27 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25259-1-PBS in a different storage buffer formulation.

DUPD1 / DUSP27 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25259-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

DUPD1, Dual specificity phosphatase 29, DUSP27, DUSP29, EC:3.1.3.16, EC:3.1.3.48

---

Product Information

25259-1-PBS targets DUPD1 / DUSP27 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19658

  Product name: Recombinant human DUPD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-150 aa of BC137322

  Sequence: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMG

• Full Name: dual specificity phosphatase and pro isomerase domain containing 1
• Calculated Molecular Weight: 220 aa, 25 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC137322
• Gene Symbol: DUSP27
• Gene ID (NCBI): 338599
• RRID: AB_3085779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q68J44
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Dupd1also named as Dusp27, has been categorized as an atypical dual-specificity phosphatase (Dusp) capable of dephosphorylating both tyrosine and serine/threonine residues. It's involved in the modulation of intracellular signaling cascades. In skeletal muscle Dupd1 regulates systemic glucose homeostasis by activating AMPK, which is an energy sensor protein kinase. Dupd1 also affects MAP kinase signaling though modulation of the MAPK1/2 cascade in skeletal muscle promoting muscle cell differentiation, development and atrophy.