DUS2L Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83265-8-RR (same clone as 83265-8-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83265-8-RR (DUS2L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83265-8-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83265-8-RR (same clone as 83265-8-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug DUS2L Recombinant antibody (83265-8-RR, Clone:240192C6) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Control Antibody (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83265-8-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83265-8-RR

  Biolayer interferometry (BLl) kinetic assays of 83265-8-RR against Human DUS2L were performed. The affinity constant is 0.321 nM.

DUS2L Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83265-8-PBS

Clone No.240192C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

240192C6, Dihydrouridine synthase 2, DUS2, EC:1.3.1.91, FLJ20399

---

Product Information

83265-8-PBS targets DUS2L in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23831

  Product name: Recombinant human DUS2L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 217-493 aa of BC006527

  Sequence: SHDHIQQYSDIEDFRQATAASSVMVARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTNTKYCLCQMLREQLESPQGRLLHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTSGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHKRKREAPDQDPGGPRAQELAQPGDLCKKPFVALGSGEESPLEGW

• Full Name: dihydrouridine synthase 2-like, SMM1 homolog (S. cerevisiae)
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC006527
• Gene Symbol: DUS2L
• Gene ID (NCBI): 54920
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NX74
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Dihydrouridine synthase 2(DUS2L), is a cytoplasmic protein that catalyzes the conversion of uridine residues to dihydrouridine in the D-loop of tRNA. transfection of DUS2 cDNA into a human lung carcinoma cell line increased dihydrouridine in tRNA, whereas transfection of DUS2 small interfering RNA (siRNA) reduced tRNA-dihydrouridine, confirming that DUS2 has dihydrouridine synthase activity.