DUS2L Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• DUS2L Recombinant monoclonal antibody (83265-8-RR)

DUS2L Uni-rAb^® Recombinant Antibody for WB, IF-P, ELISA

Cat No. 83265-8-RR Copied!

Clone No. 240192C6

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, ELISA

Synonyms

240192C6, Dihydrouridine synthase 2, DUS2, EC:1.3.1.91, FLJ20399

• 

  WB analysis using 83265-8-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83265-8-RR (DUS2L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 83265-8-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using DUS2L antibody (83265-8-RR, Clone: 240192C6 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 83265-8-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug DUS2L Recombinant antibody (83265-8-RR, Clone:240192C6) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Control Antibody (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 83265-8-RR

  Biolayer interferometry (BLl) kinetic assays of 83265-8-RR against Human DUS2L were performed. The affinity constant is 0.321 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DUS2L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, RAW 264.7 cells
• Positive IF-P detected in: mouse brain tissue
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83265-8-RR targets DUS2L in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23831

  Product name: Recombinant human DUS2L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 217-493 aa of BC006527

  Sequence: SHDHIQQYSDIEDFRQATAASSVMVARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTNTKYCLCQMLREQLESPQGRLLHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTSGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHKRKREAPDQDPGGPRAQELAQPGDLCKKPFVALGSGEESPLEGW

• Full Name: dihydrouridine synthase 2-like, SMM1 homolog (S. cerevisiae)
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC006527
• Gene Symbol: DUS2L
• Gene ID (NCBI): 54920
• RRID: AB_3670938
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NX74
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dihydrouridine synthase 2(DUS2L), is a cytoplasmic protein that catalyzes the conversion of uridine residues to dihydrouridine in the D-loop of tRNA. transfection of DUS2 cDNA into a human lung carcinoma cell line increased dihydrouridine in tRNA, whereas transfection of DUS2 small interfering RNA (siRNA) reduced tRNA-dihydrouridine, confirming that DUS2 has dihydrouridine synthase activity.

Publications

What published studies show

The DUS2L Recombinant monoclonal antibody (240192C6), catalog number 83265-8-RR, has 1 citation. It was used in a Western blot study published in Nature Chemical Biology (2026), which focused on designing a chemigenetic DNA nanotrap for norepinephrine dynamic imaging in organelles. The research falls within the fields of chemical biology and neuroscience, specifically involving neurotransmitter imaging in mouse models.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Chem Biol; Designing chemigenetic DNA nanotrap for norepinephrine dynamic imaging in organelles.; Authors - Yilin Chen