CoraLite® Plus 488-conjugated DUSP22 Monoclonal antibody

DUSP22 Monoclonal Antibody for IF/ICC
Cat No. CL488-68032
Clone No.3B8F1

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat, Rabbit

Applications

IF/ICC

DUSP22, FLJ35864, JKAP, JNK stimulatory phosphatase 1, JSP 1, JSP1, LMW DSP2, LMWDSP2, MAP kinase phosphatase x, MKP x, MKPX, VHX

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68032 targets DUSP22 in IF/ICC applications and shows reactivity with Human, Mouse, Rat, Rabbit samples.

Tested Reactivity Human, Mouse, Rat, Rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9831

Product name: Recombinant human DUSP22 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-184 aa of BC022847

Sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL

Predict reactive species
Full Name dual specificity phosphatase 22
Calculated Molecular Weight 184 aa, 21 kDa
Observed Molecular Weight21 kDa
GenBank Accession NumberBC022847
Gene Symbol DUSP22
Gene ID (NCBI) 56940
RRIDAB_3084391
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRW4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DUSP22(Dual specificity protein phosphatase 22) is also named as JSP1, LMWDSP2, MKPX. It has been demonstrated to belong to a new subgroup of small DSPs anchored at the membranes by an N-terminal myristic acid moiety and DUSP22 play a regulatory role in the JNK or p38 MAPK pathways(PMID:17384676). It has 2 isoforms produced by alternative splicing with the molecular weight of 21 kDa and 23 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DUSP22 antibody CL488-68032Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...