CoraLite® Plus 488-conjugated DUSP22 Monoclonal antibody

• 

  IF Staining of NIH/3T3 using CL488-68032

  Immunofluorescent analysis of (-20°C Methanol) fixed NIH/3T3 cells using CoraLite® Plus 488 DUSP22 antibody (CL488-68032, Clone: 3B8F1 ) at dilution of 1:100.

DUSP22 Monoclonal Antibody for IF/ICC

Cat No. CL488-68032

Clone No.3B8F1

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat, Rabbit

Applications

IF/ICC

Synonyms

DUSP22, FLJ35864, JKAP, JNK stimulatory phosphatase 1, JSP 1, JSP1, LMW DSP2, LMWDSP2, MAP kinase phosphatase x, MKP x, MKPX, VHX

---

Tested Applications

• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68032 targets DUSP22 in IF/ICC applications and shows reactivity with Human, Mouse, Rat, Rabbit samples.

• Tested Reactivity: Human, Mouse, Rat, Rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9831

  Product name: Recombinant human DUSP22 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-184 aa of BC022847

  Sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL

• Full Name: dual specificity phosphatase 22
• Calculated Molecular Weight: 184 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC022847
• Gene Symbol: DUSP22
• Gene ID (NCBI): 56940
• RRID: AB_3084391
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NRW4
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DUSP22(Dual specificity protein phosphatase 22) is also named as JSP1, LMWDSP2, MKPX. It has been demonstrated to belong to a new subgroup of small DSPs anchored at the membranes by an N-terminal myristic acid moiety and DUSP22 play a regulatory role in the JNK or p38 MAPK pathways(PMID:17384676). It has 2 isoforms produced by alternative splicing with the molecular weight of 21 kDa and 23 kDa.