CoraLite® Plus 488-conjugated DVL1 Monoclonal antibody

DVL1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67672
Clone No.1A2A5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Segment polarity protein dishevelled homolog DVL-1, DVL, DSH homolog 1, Dishevelled-1, Dishevelled 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67672 targets DVL1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26083

Product name: Recombinant human DVL1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 283-416 aa of BC050454

Sequence: LGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELA

Predict reactive species
Full Name dishevelled, dsh homolog 1 (Drosophila)
Calculated Molecular Weight 75 kDa
Observed Molecular Weight70-75 kDa
GenBank Accession NumberBC050454
Gene Symbol DVL1
Gene ID (NCBI) 1855
RRIDAB_2934559
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO14640
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DVL1 is one of three DVL homologous proteins (DVL1-3) widely expressed in embryonic development and in the adult central nervous system. Dishevelled proteins are a necessary component of the Wnt and planar cell polarity developmental signaling pathways. Overexpression of DVL1 has been linked to prostate and breast cancers through the Wnt signaling pathway. There are two isoforms of DVL1: 75 kDa and 73 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 DVL1 antibody CL488-67672Download protocol
IF protocol for CL Plus 488 DVL1 antibody CL488-67672Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...