DVL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DVL3 Polyclonal antibody, PBS Only (13444-1-PBS)

• 

  WB analysis using 13444-1-AP (same clone as 13444-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13444-1-AP (DVL3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 13444-1-AP (same clone as 13444-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 13444-1-AP (DVL3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Raji using 13444-1-AP (same clone as 13444-1-PBS)

  IP result of anti-DVL3 (IP:13444-1-AP, 4ug; Detection:13444-1-AP 1:500) with Raji cells lysate 1440ug. This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13444-1-AP (same clone as 13444-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13444-1-AP (same clone as 13444-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 13444-1-AP (same clone as 13444-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 13444-1-AP (same clone as 13444-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13444-1-AP (same clone as 13444-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 13444-1-AP (same clone as 13444-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 13444-1-AP (same clone as 13444-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13444-1-AP (same clone as 13444-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13444-1-AP (same clone as 13444-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using DVL3 antibody (13444-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13444-1-AP (same clone as 13444-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 13444-1-AP (DVL3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13444-1-PBS in a different storage buffer formulation.

DVL3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 13444-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

13444-1-PBS targets DVL3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4272

  Product name: Recombinant human DVL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-319 aa of BC032459

  Sequence: MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVL

• Full Name: dishevelled, dsh homolog 3 (Drosophila)
• Calculated Molecular Weight: 716 aa, 78 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC032459
• Gene Symbol: DVL3
• Gene ID (NCBI): 1857
• RRID: AB_2093451
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92997
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.