DcR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DcR2 Polyclonal antibody, PBS Only (16781-1-PBS)

• 

  WB analysis using 16781-1-AP (same clone as 16781-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16781-1-AP (DcR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16781-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16781-1-AP (same clone as 16781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 16781-1-AP (DcR2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16781-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16781-1-AP (same clone as 16781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 16781-1-AP (DcR2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16781-1-PBS in a different storage buffer formulation.

DcR2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16781-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CD264, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TNFRSF10D, TRAIL R4

---

Product Information

16781-1-PBS targets DcR2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10208

  Product name: Recombinant human TRAILR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-386 aa of BC052270

  Sequence: FSCRKKFISYLKGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQELAELTGVTVESPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL

• Full Name: tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
• Calculated Molecular Weight: 386 aa, 42 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC052270
• Gene Symbol: DcR2
• Gene ID (NCBI): 8793
• RRID: AB_2256181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBN6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Decoy receptor 2 (DcR2) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It functions as a decoy receptor for TNF-related apoptosis-inducing ligand (TRAIL), thereby inhibiting TRAIL-mediated apoptosis (PMID: 15538968; 9537512). It has been considered a tentative marker of cellular senescence (PMID: 16079833; 22751116). Additionally, DCR2 has been implicated in the regulation of renal fibrosis and cell senescence, contributing to the pathogenesis of diabetic nephropathy (PMID: 35661704).