Anti-Human DcR2 Rabbit Recombinant Antibody

• 

  FC experiment of human peripheral blood leukocytes using 98412-2-RR

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human DcR2 Rabbit RecAb (98412-2-RR, Clone: 242916D5) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human peripheral blood leukocytes using 98412-2-RR

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human DcR2 Rabbit RecAb (98412-2-RR, Clone: 242916D5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

DcR2 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98412-2-RR

Clone No.242916D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD264, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TNFRSF10D, TRAIL R4

---

Tested Applications

• Positive FC detected in: human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98412-2-RR targets DcR2 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3487

  Product name: Recombinant Human DcR2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 56-211 aa of NM_003840.5

  Sequence: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

• Full Name: tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: NM_003840.5
• Gene Symbol: DcR2
• Gene ID (NCBI): 8793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UBN6
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Decoy receptor 2 (DcR2) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It functions as a decoy receptor for TNF-related apoptosis-inducing ligand (TRAIL), thereby inhibiting TRAIL-mediated apoptosis (PMID: 15538968; 9537512). It has been considered a tentative marker of cellular senescence (PMID: 16079833; 22751116). Additionally, DCR2 has been implicated in the regulation of renal fibrosis and cell senescence, contributing to the pathogenesis of diabetic nephropathy (PMID: 35661704).