Use Able AI chat for product recommendations

Dectin-1/CLEC7A Recombinant monoclonal antibody, PBS Only

Dectin-1/CLEC7A Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 83739-3-PBS
Clone No.251929B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

CLEC7A, Dectin-1, Beta glucan receptor, Beta-glucan receptor, BGR

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83739-3-PBS targets Dectin-1/CLEC7A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1344

Product name: Recombinant Human Dectin-1 protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 66-247 aa of NM_197947.3

Sequence: TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM

Predict reactive species
Full Name C-type lectin domain family 7, member A
Calculated Molecular Weight28kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberNM_197947.3
Gene Symbol Dectin-1
Gene ID (NCBI) 64581
RRIDAB_3743494
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BXN2-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Dectin-1, also known as CLEC7A or CD369, is a type II membrane receptor consisting of an extracellular C-terminal C-type lectin domain, a short stalk region, a single transmembrane domain and a short N-terminal cytoplasmic tail, which contains an immunoreceptor tyrosine-based activation motif (PMID: 10779524; 21612412). Dectin-1 is expressed on monocytes, macrophages, neutrophils, dendritic cells and a subpopulation of T cells (PMID: 12244185). Dectin-1 plays a role in the innate immune response. It functions as a pattern-recognition receptor and recognizes a variety of β-glucans from fungi, plants and bacteria. Dectin-1 may also participate in orchestrating the adaptive immune response (PMID: 21612412). The apparent molecular weight is larger than the calculated molecular weight due to glycosylation (PMID: 10779524).

Loading...
||
New chat

Able

正在加载,请稍候...