Dectin-1/CLEC7A Recombinant monoclonal antibody

• 

  WB analysis using 83739-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83739-3-RR (Dectin-1/CLEC7A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 83739-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83739-3-RR against Human Dectin-1/CLEC7A were performed. The affinity constant is 12.3 nM.

Dectin-1/CLEC7A Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83739-3-RR

Clone No.251929B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CLEC7A, Dectin-1, Beta glucan receptor, Beta-glucan receptor, BGR

---

Tested Applications

• Positive WB detected in: THP-1 cells, HL-60 cells, mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83739-3-RR targets Dectin-1/CLEC7A in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1344

  Product name: Recombinant Human Dectin-1 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 66-247 aa of NM_197947.3

  Sequence: TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM

• Full Name: C-type lectin domain family 7, member A
• Calculated Molecular Weight: 28kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_197947.3
• Gene Symbol: Dectin-1
• Gene ID (NCBI): 64581
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BXN2-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dectin-1, also known as CLEC7A or CD369, is a type II membrane receptor consisting of an extracellular C-terminal C-type lectin domain, a short stalk region, a single transmembrane domain and a short N-terminal cytoplasmic tail, which contains an immunoreceptor tyrosine-based activation motif (PMID: 10779524; 21612412). Dectin-1 is expressed on monocytes, macrophages, neutrophils, dendritic cells and a subpopulation of T cells (PMID: 12244185). Dectin-1 plays a role in the innate immune response. It functions as a pattern-recognition receptor and recognizes a variety of β-glucans from fungi, plants and bacteria. Dectin-1 may also participate in orchestrating the adaptive immune response (PMID: 21612412). The apparent molecular weight is larger than the calculated molecular weight due to glycosylation (PMID: 10779524).