CoraLite® Plus 488-conjugated E2F7 Recombinant monoclonal antibody

E2F7 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-82887
Clone No.230073C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Transcription factor E2F7, E2F-7, 230073C2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82887 targets E2F7 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21599

Product name: Recombinant human E2F7 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 369-713 aa of BC136366

Sequence: VDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERIQRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPALLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPA

Predict reactive species
Full Name E2F transcription factor 7
Calculated Molecular Weight 911 aa, 100 kDa
GenBank Accession NumberBC136366
Gene Symbol E2F7
Gene ID (NCBI) 144455
RRIDAB_3673097
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96AV8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

E2F7 also named as E2F transcription factor 7 is a 911 amino acid protein, which belongs to the E2F/DP family. E2F7 localizes in the nucleus and mainly forms homodimers and, to a lesser extent, heterodimers with E2F8. E2F7 as a transcription factor involves in various processes such as angiogenesis, polyploidization of specialized cells and DNA damage response. E2F7 mainly forms homodimers and to a lesser extent, heterodimers with E2F8. (PMID: 18194653 )

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 E2F7 antibody CL488-82887Download protocol
IF protocol for CL Plus 488 E2F7 antibody CL488-82887Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...