CoraLite® Plus 488-conjugated E2F7 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-82887

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 E2F7 antibody (CL488-82887, Clone: 230073C2 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-82887

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488-conjugated E2F7 Recombinant antibody (CL488-82887, Clone:230073C2)(red), or 0.4 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

E2F7 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-82887

Clone No.230073C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

Transcription factor E2F7, E2F-7, 230073C2

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82887 targets E2F7 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21599

  Product name: Recombinant human E2F7 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 369-713 aa of BC136366

  Sequence: VDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERIQRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPALLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPA

• Full Name: E2F transcription factor 7
• Calculated Molecular Weight: 911 aa, 100 kDa
• GenBank Accession Number: BC136366
• Gene Symbol: E2F7
• Gene ID (NCBI): 144455
• RRID: AB_3673097
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96AV8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

E2F7 also named as E2F transcription factor 7 is a 911 amino acid protein, which belongs to the E2F/DP family. E2F7 localizes in the nucleus and mainly forms homodimers and, to a lesser extent, heterodimers with E2F8. E2F7 as a transcription factor involves in various processes such as angiogenesis, polyploidization of specialized cells and DNA damage response. E2F7 mainly forms homodimers and to a lesser extent, heterodimers with E2F8. (PMID: 18194653 )