E2F7 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using 82887-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using E2F7 antibody (82887-1-RR, Clone: 230073C2 ) at dilution of 1:1000 and Multi-rAb CoraLite ® Plus 594-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR004).(CL488-Phalloidin, green).

• 

  FC experiment of HeLa using 82887-1-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug E2F7 Recombinant antibody (82887-1-RR, Clone:230073C2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 82887-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82887-1-RR against Human E2F7 were performed. The affinity constant is 31.3 nM.

E2F7 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 82887-1-RR

Clone No.230073C2

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

230073C2, E2F-7, Transcription factor E2F7

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82887-1-RR targets E2F7 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21599

  Product name: Recombinant human E2F7 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 369-713 aa of BC136366

  Sequence: VDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERIQRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPALLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPA

• Full Name: E2F transcription factor 7
• Calculated Molecular Weight: 911 aa, 100 kDa
• GenBank Accession Number: BC136366
• Gene Symbol: E2F7
• Gene ID (NCBI): 144455
• RRID: AB_3670606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96AV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

E2F7 also named as E2F transcription factor 7 is a 911 amino acid protein, which belongs to the E2F/DP family. E2F7 localizes in the nucleus and mainly forms homodimers and, to a lesser extent, heterodimers with E2F8. E2F7 as a transcription factor involves in various processes such as angiogenesis, polyploidization of specialized cells and DNA damage response. E2F7 mainly forms homodimers and to a lesser extent, heterodimers with E2F8. (PMID: 18194653 )

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ekaitz (Verified Customer) (09-15-2025)

We tested this E2F7 antibody (82887-1-RR) in U2OS wild-type and E2F7 knockout cells at different dilutions. We observed the same nuclear signal in both WT and KO cells, suggesting that the detected signal is nonspecific.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:400
• Cell Tissue Type: U2OS

E2F7 Antibody Immunofluorescence validation (1:400 dilution) in U2OS (Cat no:82887-1-RR)