EEA1 Polyclonal antibody

• 

  WB analysis of HepG2 using 28347-1-AP

  WB result of EEA1 antibody (28347-1-AP; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EEA1 transfected HepG2 cells.

• 

  WB analysis using 28347-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28347-1-AP (EEA1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 28347-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28347-1-AP (EEA1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 28347-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28347-1-AP (EEA1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28347-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28347-1-AP (EEA1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 28347-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EEA1 antibody (28347-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

EEA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28347-1-AP

Publications(13)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat and More (3)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Cell and organelle markers, early endosome antigen 1, EEA1, Endosome Marker, MST105, MSTP105, ZFYVE2

---

Tested Applications

• Positive WB detected in: A431 cells, HepG2 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, C6 cells
• Positive IHC detected in: human breast cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 10 publications below

Product Information

28347-1-AP targets EEA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28814

  Product name: Recombinant human EEA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1151-1350 aa of NM_003566

  Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA

• Full Name: early endosome antigen 1
• Calculated Molecular Weight: 162 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: NM_003566
• Gene Symbol: EEA1
• Gene ID (NCBI): 8411
• RRID: AB_2881117
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15075
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Adv Mater; Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment; Authors - Yuewen Zhai
human	IF	Nucleic Acids Res; Nucleosomes enter cells by clathrin- and caveolin-dependent endocytosis.; Authors - Huawei Wang
mouse	IF	Front Immunol; Host MKRN1-Mediated Mycobacterial PPE Protein Ubiquitination Suppresses Innate Immune Response.; Authors - Yafeng Dou
Human		J Virol; Human Cytomegalovirus Hijacks WD Repeat Domain 11 for Virion Assembly Compartment Formation and Virion Morphogenesis.; Authors - Bo Yang
human	IF	Chemistry; Investigation of Glycosylphosphatidylinositol (GPI)-Plasma Membrane Interaction in Live Cells and the Influence of GPI Glycan Structure on the Interaction; Authors - Sayan Kundu
human	IF	Cell Death Dis; SorCS3 promotes the internalization of p75NTR to inhibit GBM progression.; Authors - Yanqiu Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

K. (Verified Customer) (10-26-2023)

This antibody worked nicely for WB at 1:1000 and immunoflurecence at 1:200 dilution.

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human Liver cells

FH

Sarah (Verified Customer) (02-09-2023)

Worked well for 1hr IF incubation at RT

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: hct116