• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated EEA1 Polyclonal antibody

EEA1 Polyclonal Antibody for IF/ICC
Cat No. CL647-28347

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Early endosome antigen 1, Endosome-associated protein p162, MST105, MSTP105, ZFYVE2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-28347 targets EEA1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28814

Product name: Recombinant human EEA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1151-1350 aa of NM_003566

Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA

Predict reactive species
Full Name early endosome antigen 1
Calculated Molecular Weight 162 kDa
Observed Molecular Weight 170 kDa
GenBank Accession NumberNM_003566
Gene Symbol EEA1
Gene ID (NCBI) 8411
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15075
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 EEA1 antibody CL647-28347Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...