EEF1A1 Recombinant monoclonal antibody

• 

  WB analysis of HepG2 using 81377-1-RR

  WB result of EEF1A1 antibody (81377-1-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EEF1A1 transfected HepG2 cells.

• 

  WB analysis using 81377-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81377-1-RR (EEF1A1 antibody) at dilution of 1:12000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 81377-1-RR

  IP result of anti-EEF1A1 (IP:81377-1-RR, 4ug; Detection:81377-1-RR 1:8000) with HeLa cells lysate 1720 ug.

• 

  IHC staining of human pancreas cancer using 81377-1-RR

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 81377-1-RR (EEF1A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 81377-1-RR

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 81377-1-RR (EEF1A1 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 81377-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 81377-1-RR (EEF1A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 81377-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 81377-1-RR (EEF1A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 81377-1-RR

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 81377-1-RR (EEF1A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 81377-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EEF1A1 antibody (81377-1-RR, Clone: 2B16 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 81377-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using EEF1A1 antibody (81377-1-RR, Clone: 2B16 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  Affinity and Kinetic Characterization of 81377-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81377-1-RR against Human EEF1A1 were performed. The affinity constant is 25.3 nM.

• Featured Product
• KD/KO Validated

EEF1A1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 81377-1-RR

Clone No.2B16

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EEF1A, EEF 1, EC:3.6.5.-, CCS3, CCS 3

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse brain tissue, human pancreas cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81377-1-RR targets EEF1A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1938

  Product name: Recombinant human EEF1A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 144-462 aa of BC014224

  Sequence: GVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK

• Full Name: eukaryotic translation elongation factor 1 alpha 1
• Calculated Molecular Weight: 462 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC014224
• Gene Symbol: EEF1A1
• Gene ID (NCBI): 1915
• RRID: AB_2935549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P68104
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EEF1A1, also named as EEF1A, EF1A and LENG7, belongs to the GTP-binding elongation factor family. This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.1 It is a typical housekeeping gene product required for the maintenance of cell proliferation and/or survival. In addition, EEF1A1 protects the aminoester bond against hydrolysis until a correct match between the codon on mRNA and the anti-codon on tRNA can be achieved.