• Featured Product
  • KD/KO Validated

EEF1A1 Recombinant monoclonal antibody

EEF1A1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 81377-1-RR
Clone No.2B16

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

EEF1A, EEF 1, EC:3.6.5.-, CCS3, CCS 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells
Positive IP detected inHeLa cells
Positive IHC detected inmouse brain tissue, human pancreas cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81377-1-RR targets EEF1A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1938

Product name: Recombinant human EEF1A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 144-462 aa of BC014224

Sequence: GVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK

Predict reactive species
Full Name eukaryotic translation elongation factor 1 alpha 1
Calculated Molecular Weight 462 aa, 50 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC014224
Gene Symbol EEF1A1
Gene ID (NCBI) 1915
RRIDAB_2935549
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP68104
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EEF1A1, also named as EEF1A, EF1A and LENG7, belongs to the GTP-binding elongation factor family. This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.1 It is a typical housekeeping gene product required for the maintenance of cell proliferation and/or survival. In addition, EEF1A1 protects the aminoester bond against hydrolysis until a correct match between the codon on mRNA and the anti-codon on tRNA can be achieved.

Protocols

Product Specific Protocols
IF protocol for EEF1A1 antibody 81377-1-RRDownload protocol
IHC protocol for EEF1A1 antibody 81377-1-RRDownload protocol
IP protocol for EEF1A1 antibody 81377-1-RRDownload protocol
WB protocol for EEF1A1 antibody 81377-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...