• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated EEF1A1 Recombinant monoclonal antibody

EEF1A1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-81377
Clone No.2B16

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

2B16, CCS 3, CCS3, EC:3.6.5.-, EEF 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81377 targets EEF1A1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1938

Product name: Recombinant human EEF1A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 144-462 aa of BC014224

Sequence: GVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK

Predict reactive species
Full Name eukaryotic translation elongation factor 1 alpha 1
Calculated Molecular Weight 462 aa, 50 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC014224
Gene Symbol EEF1A1
Gene ID (NCBI) 1915
RRIDAB_3084501
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP68104
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EEF1A1, also named as EEF1A, EF1A and LENG7, belongs to the GTP-binding elongation factor family. This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. It is a typical housekeeping gene product required for the maintenance of cell proliferation and/or survival. In addition, EEF1A1 protects the aminoester bond against hydrolysis until a correct match between the codon on mRNA and the anti-codon on tRNA can be achieved.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 EEF1A1 antibody CL488-81377Download protocol
IF protocol for CL Plus 488 EEF1A1 antibody CL488-81377Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...