EEF1G Monoclonal antibody, PBS Only

• 

  WB analysis using 68148-1-Ig (same clone as 68148-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68148-1-Ig (EEF1G antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68148-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68148-1-Ig (same clone as 68148-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68148-1-Ig (EEF1G antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68148-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68148-1-Ig (same clone as 68148-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68148-1-Ig (EEF1G antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68148-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68148-1-Ig (same clone as 68148-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68148-1-Ig (EEF1G antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68148-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 68148-1-Ig (same clone as 68148-1-PBS)

  WB result of EEF1G antibody (68148-1-Ig; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EEF1G transfected MCF-7 cells. This data was developed using the same antibody clone with 68148-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68148-1-Ig (same clone as 68148-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using EEF1G antibody (68148-1-Ig, Clone: 1G7C6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68148-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68148-1-Ig (same clone as 68148-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using EEF1G antibody (68148-1-Ig, Clone: 1G7C6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68148-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EEF1G Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68148-1-PBS

Clone No.1G7C6

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig, rabbit

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

eEF 1B gamma, eEF-1B gamma, EF 1 gamma, EF1G, EF-1-gamma

---

Product Information

68148-1-PBS targets EEF1G in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig, rabbit samples.

• Tested Reactivity: human, pig, rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0218

  Product name: Recombinant human EEF1G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-400 aa of BC006520

  Sequence: GLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWR

• Full Name: eukaryotic translation elongation factor 1 gamma
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC006520
• Gene Symbol: EEF1G
• Gene ID (NCBI): 1937
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P26641
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Eukaryotic translation elongation factor 1 (EEF1G, synonym: EF1G) is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.