EFHB Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EFHB Polyclonal antibody, PBS Only (17352-1-PBS)

• 

  IHC staining of mouse testis using 17352-1-AP (same clone as 17352-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17352-1-AP (EFHB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17352-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 17352-1-AP (same clone as 17352-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using EFHB antibody (17352-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17352-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 17352-1-AP (same clone as 17352-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using EFHB antibody (17352-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17352-1-PBS in a different storage buffer formulation.

EFHB Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 17352-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

CFAP21, Cilia- and flagella-associated protein 21, EF-hand domain-containing family member B

---

Product Information

17352-1-PBS targets EFHB in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11431

  Product name: Recombinant human EFHB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 319-669 aa of BC028198

  Sequence: RADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRGKDRQRALIAAVRHHLKKVNYQKFDTLLAAFRHYDKKGDGMIDKDELQEACDQANLSLDDKLLDQLFDYCDVDNDGFINYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANVEEPEQTLLIKPEDIVLKEAGSTEKTLRTLLRPSDKVSNYYKTTSSEINAIVGAIPSTCYPICGVPTIRSDIPAPRIRRISDRTNYGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEEFENVWNLASKKHHRGEVCVENIRNVLDELRHADRIKCKTLM

• Full Name: EF-hand domain family, member B
• Calculated Molecular Weight: 669aa,76 kDa; 831aa,94 kDa
• GenBank Accession Number: BC028198
• Gene Symbol: EFHB
• Gene ID (NCBI): 151651
• RRID: AB_3741917
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N7U6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EFHB (EF-hand domain family member B, also known as CFAP21) interacts with Orai1 in a Ca2+-dependent manner. Human EFHB is an 833-amino acid cytosolic protein with two EF-hand domains between amino acids 561-596 and 597-632 (PMID: 34439314).