EIF2AK4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EIF2AK4 Polyclonal antibody, PBS Only (27944-1-PBS)

• 

  WB analysis using 27944-1-AP (same clone as 27944-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27944-1-AP (EIF2AK4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27944-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 27944-1-AP (same clone as 27944-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 27944-1-AP (EIF2AK4 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 27944-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 27944-1-AP (same clone as 27944-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 27944-1-AP (EIF2AK4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 27944-1-PBS in a different storage buffer formulation.

EIF2AK4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27944-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.7.11.1, eIF-2-alpha kinase GCN2, Eukaryotic translation initiation factor 2-alpha kinase 4, GCN2, GCN2 like protein

---

Product Information

27944-1-PBS targets EIF2AK4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27617

  Product name: Recombinant human EIF2AK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 875-1080 aa of BC009350

  Sequence: AFSADSKQDDQTGDLIKSDPSGHLTGMVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLTNVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA

• Full Name: eukaryotic translation initiation factor 2 alpha kinase 4
• Calculated Molecular Weight: 187 kDa
• Observed Molecular Weight: ~200 kDa
• GenBank Accession Number: BC009350
• Gene Symbol: EIF2AK4
• Gene ID (NCBI): 440275
• RRID: AB_3669630
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2K8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EIF2AK4 (eukaryotic translation initiation factor 2 α kinase 4), formerly known as GCN2, a member of serine/threonine kinases, is comprised of an N-terminal RWD domain (20-137) involved in protein-protein interactions, pseudokinase (276-539) and kinase domains (585-1016) and C-terminal domain (1533-1649) where binding to ribosomes and recognition of uncharged tRNAs occur. It downregulates protein synthesis in response to a variety of cellular stress such as hypoxia, viral infection, and amino acid deprivation (PMID: 38776952, 26300654). Mutant EIF2AK4 could promote proliferation of small pulmonary arteries by crosstalk with mammalian targets of the rapamycin signaling pathway (PMID: 24135949).