CoraLite® Plus 488-conjugated EIF3F Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-84131-2

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 EIF3F antibody (CL488-84131-2, Clone: 240894D2 ) at dilution of 1:200.

• 

  FC experiment of U2OS using CL488-84131-2

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug Coralite® Plus 488 Eif3f Recombinant Antibody (CL488-84131-2, Clone:240894D2)(red), or 0.25 ug CoraLite® Plus 488 Rabbit IgG Isotype Control Recombinant Antibody (CL488-98136, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

EIF3F Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-84131-2

Clone No.240894D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

240894D2, eIF3 p47

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84131-2 targets EIF3F in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34849

  Product name: Recombinant human EIF3F protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 105-357 aa of BC000490

  Sequence: SYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

• Full Name: eukaryotic translation initiation factor 3, subunit F
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC000490
• Gene Symbol: EIF3F
• Gene ID (NCBI): 8665
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00303
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

EIF3F (eukaryotic translation initiation factor 3 subunit F) is a protein that plays an important role in eukaryotic cells and is an integral part of the translation initiation factor 3(Eif3) complex. EIF3 is a complex of at least 10 distinct subunits and is the largest translation initiation factor in eukaryotes.