Home
Products
Primary Antibodies
EIF3J Polyclonal antibody, PBS Only (10439-1-PBS)

Filter: AllWBIPIHCIF/ICC

WB analysis of HeLa using 10439-1-AP (same clone as 10439-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 10439-1-AP (same clone as 10439-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 10439-1-AP (same clone as 10439-1-PBS)
MCF7 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 10439-1-AP (same clone as 10439-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 10439-1-AP (same clone as 10439-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
WB analysis of K-562 using 10439-1-AP (same clone as 10439-1-PBS)
K-562 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
WB analysis of SKOV-3 using 10439-1-AP (same clone as 10439-1-PBS)
SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 10439-1-AP (same clone as 10439-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 10439-1-AP (same clone as 10439-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 10439-1-AP (same clone as 10439-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
IP experiment of HeLa using 10439-1-AP (same clone as 10439-1-PBS)
IP result of anti-EIF3J (IP:10439-1-AP, 4ug; Detection:10439-1-AP 1:500) with HeLa cells lysate 880ug. This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 10439-1-AP (same clone as 10439-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer using 10439-1-AP (EIF3J antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 10439-1-AP (same clone as 10439-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer using 10439-1-AP (EIF3J antibody) at dilution of 1:10 (under 10x lens). This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 10439-1-AP (same clone as 10439-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using EIF3J antibody (10439-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10439-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

EIF3J Polyclonal antibody, PBS Only

Name: EIF3J Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 10439-1-PBS

EIF3J Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10439-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Eukaryotic translation initiation factor 3 subunit 1, EIF3S1, eIF-3-alpha, eIF3 p35, eIF3 alpha

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

10439-1-PBS targets EIF3J in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0678 Product name: Recombinant human EIF3J protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC002719 Sequence: MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM Predict reactive species
Full Name	eukaryotic translation initiation factor 3, subunit J
Calculated Molecular Weight	28 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC002719
Gene Symbol	EIF3J
Gene ID (NCBI)	8669
RRID	AB_2097082
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75822
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

EIF3 has a key role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex(PMID:17588516). The eIF3 complex stimulates several steps in the translation initiation pathway, including dissociation of 80S ribosomes into 40S and 60S subunits, binding of a ternary complex (TC) consisting of Met-tRNA , eIF2, and GTP to the small subunit (forming the 43S preinitiation complex) and recruitment of mRNA to the 43 S complex to produce the 48S complex (PMID:11560931) EIF3J was identified as a high copy suppressor of the temperature-sensitive (Ts-) phenotype of the rpg1-1 allele of TIF32/RPG1, encoding the largest subunit of yeast eIF3 (eIF3a) (PMID:10488093).