Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated EIF3M Monoclonal antibody

EIF3M Monoclonal Antibody for IF/ICC

Cat No. CL488-66025
Clone No.2A12B2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF/ICC

B5, EIF3M, Fetal lung protein B5, FLJ29030, GA17, hfl B5, HFLB5, PCID1, PNAS 125

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66025 targets EIF3M in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17965

Product name: Recombinant human EIF3M protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-374 aa of BC019103

Sequence: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Predict reactive species
Full Name eukaryotic translation initiation factor 3, subunit M
Calculated Molecular Weight 374 aa, 43 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC019103
Gene Symbol EIF3M
Gene ID (NCBI) 10480
RRIDAB_2934445
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7L2H7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EIF3M gene encodes eukaryotic translation initiation factor (eIF) subunit M, also called GA17 or PCID1. eIF-3 complex is required for several steps in the initiation of protein synthesis, and recent studies indicate that regulation of oncogene expression and neoplastic transformation are controlled by eIF subunits. The most uncharacterized non-core subunit EIF3M was confirmed to be highly expressed in human cancer cell lines and colon cancer patient tissues and mediate regulation of tumorigenesis-related genes in human colon cancer.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 EIF3M antibody CL488-66025Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...