CoraLite® Plus 488-conjugated EIF5A2 Monoclonal antibody

EIF5A2 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67907
Clone No.1F9B2

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF/ICC, FC (Intra)

EIF5A1/EIF5A2, eIF5AII, eIF-5A-2, eIF-5A2, EIF 5A2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67907 targets EIF5A2 in IF/ICC, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10852

Product name: Recombinant human EIF5A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-153 aa of BC036072

Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK

Predict reactive species
Full Name eukaryotic translation initiation factor 5A2
Calculated Molecular Weight 153 aa, 17 kDa
Observed Molecular Weight20 kDa
GenBank Accession NumberBC036072
Gene Symbol EIF5A2
Gene ID (NCBI) 56648
RRIDAB_2934587
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9GZV4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Eukaryotic translation initiation factor 5A (EIF5A), a conserved lysine to hypusine, is strictly indispensable for the survival of eukaryotic cells. There are two EIF5A isoforms in humans: EIF5A1 and EIF5A2. EIF5A2 has been reported to be overexpressed in gallbladder cancer, upper urinary tract urothelial carcinoma, gastric cancer, prostate cancer, nasopharyngeal carcinoma, and cervical cancer. EIF5A2 upregulation in cancer tissues is associated with poor prognosis in these patients.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 EIF5A2 antibody CL488-67907Download protocol
IF protocol for CL Plus 488 EIF5A2 antibody CL488-67907Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...