Product Information
20308-1-PBS targets ELOVL2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14143 Product name: Recombinant human ELOVL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 77-185 aa of BC050278 Sequence: LLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYS Predict reactive species |
| Full Name | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2 |
| Calculated Molecular Weight | 296 aa, 35 kDa |
| GenBank Accession Number | BC050278 |
| Gene Symbol | ELOVL2 |
| Gene ID (NCBI) | 54898 |
| RRID | AB_10666201 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NXB9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |







