ELOVL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ELOVL2 Polyclonal antibody, PBS Only (20308-1-PBS)

• 

  IHC staining of human testis using 20308-1-AP (same clone as 20308-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20308-1-AP (ELOVL2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20308-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20308-1-AP (same clone as 20308-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20308-1-AP (ELOVL2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20308-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 20308-1-AP (same clone as 20308-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20308-1-AP (ELOVL2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20308-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 20308-1-AP (same clone as 20308-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20308-1-AP (ELOVL2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20308-1-PBS in a different storage buffer formulation.

ELOVL2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 20308-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

20308-1-PBS targets ELOVL2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14143

  Product name: Recombinant human ELOVL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 77-185 aa of BC050278

  Sequence: LLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYS

• Full Name: elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2
• Calculated Molecular Weight: 296 aa, 35 kDa
• GenBank Accession Number: BC050278
• Gene Symbol: ELOVL2
• Gene ID (NCBI): 54898
• RRID: AB_10666201
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXB9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.