ELOVL6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ELOVL6 Polyclonal antibody, PBS Only (21160-1-PBS)

• 

  IHC staining of human hepatocirrhosis using 21160-1-AP (same clone as 21160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 21160-1-AP (ELOVL6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21160-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 21160-1-AP (same clone as 21160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 21160-1-AP (ELOVL6 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 21160-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 21160-1-AP (same clone as 21160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 21160-1-AP (ELOVL6 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 21160-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21160-1-AP (same clone as 21160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21160-1-AP (ELOVL6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21160-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21160-1-AP (same clone as 21160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21160-1-AP (ELOVL6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21160-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 21160-1-AP (same clone as 21160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 21160-1-AP (ELOVL6 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 21160-1-PBS in a different storage buffer formulation.

ELOVL6 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21160-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

3-keto acyl-CoA synthase ELOVL6, EC:2.3.1.199, ELOVL FA elongase 6, ELOVL fatty acid elongase 6, FACE

---

Product Information

21160-1-PBS targets ELOVL6 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14163

  Product name: Recombinant human ELOVL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC001305

  Sequence: MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALR

• Full Name: ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)
• Calculated Molecular Weight: 265 aa, 31 kDa
• GenBank Accession Number: BC001305
• Gene Symbol: ELOVL6
• Gene ID (NCBI): 79071
• RRID: AB_10694572
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5J4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.