EMC7/C15orf24 (Human Specific) Monoclonal antibody

• 

  WB analysis using 68722-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68722-1-Ig (C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68722-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68722-1-Ig (EMC7/C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 68722-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 68722-1-Ig (C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

EMC7/C15orf24 (Human Specific) Monoclonal Antibody for WB, ELISA

Cat No. 68722-1-Ig

Clone No.1D7A6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

C15orf24, EMC7, 1D7A6, C11orf3, Endoplasmic reticulum membrane protein complex subunit 7

---

Tested Applications

• Positive WB detected in: HeLa cells, LNCaP cells, MCF-7 cells, HEK-293 cells, Jurkat cells, K-562 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68722-1-Ig targets EMC7/C15orf24 (Human Specific) in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26813

  Product name: Recombinant human C15orf24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-159 aa of BC104934

  Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD

• Full Name: chromosome 15 open reading frame 24
• Observed Molecular Weight: 20-26 kDa
• GenBank Accession Number: BC104934
• Gene Symbol: EMC7
• Gene ID (NCBI): 56851
• RRID: AB_3670414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NPA0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins.